Skip to main content

Table 5 Theoretical and obtained peptides mass generated by Lys-C digestion of rPstS-1 produced in P. pastoris

From: Recombinant O-mannosylated protein production (PstS-1) from Mycobacterium tuberculosis in Pichia pastoris (Komagataella phaffii) as a tool to study tuberculosis infection

Peptide name Position of cleavage site Peptide Length (aa) Theoretical Peptide mass (Da) Modification Peptide mass (Da)
P1 6 AGCGSK 6 521.589   ND
P2 97 PPSGSPETGAGAGTVATTPASSPVTLAETGSTL
LYPLFNLWGPAFHERYPQVTITAQGTGSGAGIA
QAAAGTVNIGASDAYLSEGDMAAHK
91 8916.801   ND
P3 123 GLMNIALAISAQQVNYNLPGVSEHLK 26 2781.222   ND
P4 127 LNGK 4 430.504   ND
P5 138 VLAAMYQGTIK 11 1194.455   ND
P6 180 TWDDPQIAALNPGVNLPGTAVVPLHRSDGSGD
TFLFTQYLSK
42 4500.004   ND
P7 188 QDPEGWGK 8 915.958   D) 916.41
P8 270 SPGFGTTVDFPAVPGALGENGNGGMVTGCAE
TPGCVAYIGISFLDQASQRGLGEAQLGQSSGN
FLLPDAQSIQAAAAGFASK
82 8005.854   D) 8001.84
P9 303 TPANQAISMIDGPAPDGYPIINYEYAIVNNRQK 33 3635.065   D) 3633.80
P10 324 DAATAQTLQAFLHWAITDGNK 21 2272.502   D) 2272.13
P11 342 ASFLDQVHFQPLPPAVVK 18 1993.336   ND
P12 353 LSDALIATISS 11 1090.239   ND
  1. Mark of D) referred the mass spectrum from Fig. 4d
  2. Hex hexose, ND no determined