Table 1 Observed molecular weights of OmpF peptide fragments digested with trypsin and measured by liquid chromatography-mass spectrometry
From: Construction of a bacterial surface display system based on outer membrane protein F
Fragment | Peptide sequence | Theoretical M.W. (Da) | Observed M.W. (Da) | ||
|---|---|---|---|---|---|
Lot 1 | Lot 2 | Lot 3 | |||
1 | YADVGSFNYGR | 1248.541 | 1249.605 | 1249.596 | 1249.638 |
2 | YDANNIYLAANYGETR | 1846.849 | 1847.867 | 1847.877 | 1847.931 |
3 | NYGVVYDALGYTDMLPEFGGDTAYSDDFFVGR | 3553.566 | 3554.815 | 3554.632 | 3554.830 |
4 | GETQINSDLTGYGQWEYNFQGNNSEGADAQTGNK | 3693.573 | 3693.868 | Â | 3694.669 |