Skip to main content

Table 4 Theoretical and obtained peptides mass generated by Trypsin digestion of rPstS-1 produced in P. pastoris

From: Recombinant O-mannosylated protein production (PstS-1) from Mycobacterium tuberculosis in Pichia pastoris (Komagataella phaffii) as a tool to study tuberculosis infection

Peptide name Position of cleavage site Peptide Length (aa) Theoretical Peptide mass (Da) Modification Peptide mass (Da)
P1T 54 AGCGSKPPSGSPETGAGAGTVATTPASSPVTLA
ETGSTLLYPLFNLWGPAFHER
54 5315.900   ND
P2T 97 YPQVTITAQGTGSGAGIAQAAAGTVNIGASDAYL
SEGDMAAHK
43 4122.489   B) 4120.98
P3T 123 GLMNIALAISAQQVNYNLPGVSEHLK 26 2781.222
+2 Hex 3105.22
+4 Hex 3429.22
+5 Hex 3591.22
P3T + 2 Hex
P3T + 4 Hex
P3T + 5 Hex
B) 3105.78
C) 3429.46
C) 3590.15
P4T 127 LNGK 4 430.504   ND
P5T 138 VLAAMYQGTIK 11 1194.455 P5T + 6 Hex B) 2166.65
P6T 164 TWDDPQIAALNPGVNLPGTAVVPLHR 26 2752.125   B) 2751.45
P7T 180 SDGSGDTFLFTQYLSK 16 1765.894   C) 1765.82
P8T 188 QDPEGWGK 8 915.958   ND
P9T 238 SPGFGTTVDFPAVPGALGENGNGGMVTGCAE
TPGCVAYIGISFLDQASQR
50 4918.459   C) 4916.29
P10T 270 GLGEAQLGQSSGNFLLPDAQSIQAAAAGFASK 32 3105.411   B) 3104.56
C) 3105.89
P11T 301 TPANQAISMIDGPAPDGYPIINYEYAIVNNR 31 3378.761   B) 3377.64
C) 3379.80
P12T 303 QK 2 274.320   ND
P13T 324 DAATAQTLQAFLHWAITDGNK 21 2272.502   B) 2272.13
C) 2271.81
P14T 342 ASFLDQVHFQPLPPAVVK 18 1993.336   B) 1993.08
C) 1994.49
P15T 353 LSDALIATISS 11 1090.239 P15T + 4 Hex B) 1738.59
  1. Mark of B) and C) referred the mass spectra from Fig. 4b and c, respectively
  2. Hex hexose, ND no determined, T trypsin, aa amino acids