Skip to main content

Table 5 Lunasin-like polypeptides sequences

From: Italian legumes: effect of sourdough fermentation on lunasin-like polypeptides

WSE Protein Sequencea NCBI accession number Theoretical mass (kDa) Sequence coverage Mascot score
FL-S Subtilisin inhibitor 1 (Vigna angularis) QEQGTNPSQEQNVPLPRNYKQALETNTPTKTSWPELVGVTAEQAETKIKEEMVDVQIQVSPHDSFVTADYNPKRVRLYVDESNKVTRTPSIG P16064 10.38 82 114
  Legumin A2 (Pisum sativum) MATKLLALSLSFCFLLLGGCFALREQPEQNECQLERLNALEPDNRIESEGGLIETWNPNNKQFRCAGVALSRATLQHNALRRPYYSNAPQEIFIQQGNGYFGMVFPGCPETFEEPQESEQGEGRRYRDRHQKVNRFREGDIIAVPTGIVFWMYNDQDTPVIAVSLTDIRSSNNQLDQMPRRFYLAGNHEQEFLRYQHQQGGKQEQENEGNNIFSGFKRDFLEDAFNVNRHIVDRLQGRNEDEEKGAIVKVKGGLSIISPPEKQARHQRGSRQEEDEDEDEERQPRHQRGSRQEEEEDEDEERQPRHQRRRGEEEEEDKKERRGSQKGKSRRQGDNGLEETVCTAKLRLNIGPSSSPDIYNPEAGRIKTVTSLDLPVLRWLKLSAEHGSLHKNAMFVPHYNLNANSIIYALKGRARLQVVNCNGNTVFDGELEAGRALTVPQNYAVAAKSLSDRFSYVAFKTNDRAGIARLAGTSSVINNLPLDVVAATFNLQRNEARQLKSNNPFKFLVPARQSENRASA P15838 59.63 62 410
  Phaseolin (Phaseolus vulgaris) MMRARVPLLLLGILFLASLSASFATSLREEEESQDNPFYFNSDNSWNTLFKNQYGHIRVLQRFDQQSKRLQNLEDYRLVEFRSKPETLLLPQQADAELLLVVRSGSAILVLVKPDDRREYFFLTSDNPIFSDHQKIPAGIFYLVNPDPKEDLRIIQLAMPVNNPQIHEFFLSSTEAQQSYLQEFSKHILEASFNSKFEEINRVLFEEEGQQEGVIVNIDSEQIKELSKHAKSSSRKSLSKQDNTIGNEFGNLTERTDNSLNVLISSIEMEEGALFVPHYYSKAIVILVVNEGEAHVELVGPKGNKETLEYESYRAELSKDDVFVIPAAYPVAIKATSNVNFTGFGINANNNNRNLLAGKTDNVISSIGRALDGKDVLGLTFSGSGDEVMKLINKQSGSYFVDAHHHQQEQQKGRKGAFVY P02853 47.540 75 515
CV-S Leucoagglutinating phytohemagglutinin (Phaseolus vulgaris) MASSKFFTVLFLVLLTHANSSNDIYFNFQRFNETNLILQRDASVSSSGQLRLTNLNGNGEPRVGSLGRAFYSAPIQIWDNTTGTVASFATSFTFNIQVPNNAGPADGLAFALVPVGSQPKDKGGFLGLFDGSNSNFHTVAVEFDTLYNKDWDPTERHIGIDVNSIRSIKTTRWDFVNGENAEVLITYDSSTNLLVASLVYPSQKTSFIVSDTVDLKSVLPEWVSVGFSATTGINKGNVETNDVLSWSFASKLSDGTTSEGLNLANLVLNKIL P05087 29.54 61 506
  Pathogenesis related protein (Cicer arietinum) MGVFTFEQETASTVPPAKLYKAMVKDADVIIPKAVDAIKTVETVEGNGGPGTIKKLTFVEGGQTLYVLHKIEAIDEANLGYNYSIVGGAGLSETVERYHFEAKLCEGPNGGSIGKVSVKYQTKGDAKPNEKEVQEGKAKGDALFKAIEGYVLANPNYN CAA56142 16.93 83 408
  Seed linoleate 9S-lipoxygenase-3 (Pisum sativum) MFSGVTGILNRGHKIKGTVVLMRKNVLDINSLTTVGGVIGQGFDILGSTVDNLTAFLGRSVSLQLISATKPDATGKGKLGKATFLEGIISSLPTLGAGQSAFKIHFEWDDDMGIPGAFYIKNFMQTEFFLVSLTLDDIPNHGSIYFVCNSWIYNAKHHKIDRIFFANQTYLPSETPAPLVHYREEELNNLRGDGTGERKEWERIYDYDVYNDLGNPDSGENHARPVLGGSETYPYPRRGRTGRKPTRKDPNSESRSDYVYLPRDEAFGHLKSSDFLTYGLKAVSQNVVPALESVFFDLNFTPNEFDSFDEVHGLYEGGIKLPTNILSQISPLPVLKEIFRTDGENTLKYPPPKVIQVSRSGWMTDEEFAREMLAGVNPNVICCLQEFPPRSKLDSQIYGDHTSKISKEHLEPNLEGLTVEEAIQNKKLFLLDHHDSIMPYLRRINSTSTKAYATRTILFLNNNQNLKPLAIELSLPHPQGDEHGAVSYVYQPALEGVESSIWLLAKAYVIVNDSCYHQLVSHWLNTHAVVEPFVIATNRHLSCLHPIYKLLYPHYRDTMNINSLARLSLVNDGGIIEKTFLWGRYSMEMSSKVYKNWVFTEQALPADLIKRGMAIEDPSSPCGVKLVVEDYPYAVDGLEIWAIIKTWVQDYVSLYYTSDEKLRQDSELQAWWKELVEVGHGDKKNEPWWPKMQTREDLIEVCSIVIWTASALHAAVNFGQYSYGGLILNRPTLSRRFMPEKGSAEFEELVKSPQKAYLKTITPKFQTLIDLSVIEILSRHASDELYLGERDNPNWTSDKRALEAFKKFGNKLAEIEKKLTQRNNDEKLRNRHGPVEMPYTLLYPSSKEGLTFRGIPNSISI P09918 97.57 43 207
PS-S Provicilin (Pisum sativum) DNAEIEKILLEEHEKETHHRRGLRDKRQQSQEKNVIVKVSKKQIEELSKNAKSSSKKSVSSRSEPFNLKSSDPIYSNQYGKFFEITPKKNPQLQDLDIFVNYVEIKEGSLWLPHYNSRAIVIVTVNEGKGDFELVGQRNENQQGLREEDDEEEEQREEETKNQVQSYKAKLTPGDVFVIPAGHPVAVRASSNLNLLGFGINAENNQRNFLAGEEDNVISQIQKQVKDLTFPGSAQEVDRLLENQKQSYFANAQPQQRETRSQEIKEHLYSILGAF P02855 31.52 53 589
  Seed linoleate 9S-lipoxygenase-2 (Pisum sativum) MFPNVTGLLNKGHKIRGTVVLMRKNVLDFNTIVSIGGGNVHGVIDSGINIIGSTLDGLTAFLGRSVSLQLISATKSDANGKGKVGKDTFLEGVLASLPTLGAGESAFNIHFEWDHEMGIP121GAFYIKNYMQVEFFLKSLTLEDVPNHGTIRFVCNSWVYNSKLYKSPRIFFANKSYLPSETPSPLVKYREEELQTLRGDGTGERKLHERIYDYDVYNDLGNPDHGEHLARPILGGSSTHPYPRRGRTGRYPTRKDPNSEKPATETYVPRDENFGHLKSSDFLAYGIKSVSQCVVPAFESAFDLNFTPNEFDSFQDVRNLFEGGIKLPLDVISTLSPLPVVKEIFRTDGEQVLKFTPPHVIRVSKSAWMTDEEFAREMLAGVNPCMIRGLQEFPPKSNLDPAEYGDHTSKISVDVLNLDGCTIDEALASGRLFILDYHDTFIPFLRRINETSAKAYATRTILFLKENGTLKPVAIELSLPHPDGDKSGFVSKVILPADEGVESTIWLLAKAYVVVNDSCYHQLMSHWLNTHAVIEPFVIATNRQLSVVHPINKLLAPHYRDTMMNINALARDSLINANGLIERSFLPSKYAVEMSSAVYKYWVFTDQALPNDLIKRNMAVKDSSSPYGLRLLIEDYPYAVDGLEIWTAIKTWVQDYVSLYYATDNDIKNDSELQHWWKEVVEKGHGDLKDKPWWPKLQTFDELVEVCTIIIWTASALHAAVNFGQYPYGGLILNRPTLSRRLLPEEGTAEYDEMVKSSQKAYLRTITPKFQTLIDLSVIEILSRHASDEVYLGQRENPHWTSDSKALQAFQKFGNKLAEIEAKLTNKNNDPSLYHRVGPVQLPYTLLHPSSKEGLTFRGIPNSISI P14856 97.07 36 178
  Seed biotin-containing protein SBP65 (Pisum sativum) MASEQLSRRENITTERKIQNAEDSVPQRTTHFELRETHELGPNFQSLPRNENQAYLDRGARAPLSANVSESYLDRARVPLNANIPEHRVREKEDFGGVRDMGKFQMESKGGNKSLAEDRETLDTRSRMVTGTPHIKEASGKGQVVEERERARERAMEEEEKRLTMEEISKYRNQAQQSALEALSAAQEKYERAKQATNETLRNTTQAAQEKGEAAQAKDATFEKTQQGYEMTGDTVSNSARTASEKAAQAKNTTLGKTQQGYEATRDTVSNAARTAAEYATPAAEKARCVAVQAKDVTLETGKTAAEKAKCAAEIAAKVAVDLKEKATVAGWTASHYATQLTVDGTRAAANAVEGAVGYVAPKASELAAKSVETVKGLAASAGETAKEFTARKKEESWREYEAKRASQLQEGEEILPSTGGIGKVLPSGERTQAQGTNLQEKVQGKGSDILGAVTETVSDIGSSMIKPIDNANTKVKEHGGTTITPKGQDAGGVLDAIGETIAEIAHTTKVIVVGEDDEVEKSMQKNIGSDSHSLDRAKHEGYRAPKNNVS Q41060 59.52 46 783
  Albumin-1 C (Pisum sativum) MASVKLASLIVLFATLGMFLTKNVGAISCNGVCSPFDIPPCGSPLCRCIPAGLVIGNCRNPYGVFLRTNDEHPNLCESDADCRKKGSGTFCGHYPNPDIEYGWCFASKSEAEDVFSKITPKDLLKSVSTA P62928 13.90 55 333
  1. Identification was carried out by nano-LC–ESI–MS–MS. Polypeptides were purified from water/salt-soluble extracts obtained from sourdoughs (-S) made with Fagiolo di Lamon (FL), Cece dell’Alta Valle del Misa (CV), and Pisello riccio di Sannicola (PS)
  2. aSingle-letter amino acid code is used