Skip to main content

Advertisement

Table 3 Signal peptide sequence identified in each enzyme

From: Hyper secretion of Thermobifida fusca β-glucosidase via a Tat-dependent signal peptide using Streptomyces lividans

Signal name Secretion system Amino acids sequences
Plds Sec MLRHRLRRLH RLTRSAAVSAVVLAALPAAPAFAS
XCs Tat MQQDGTQQDRIKQSPAPLNGMSRRGFLGGAGTLALATASGLLLPGTAHA
Tfu0620s Tat MSKVRATNRRSWMRRGLAAASGLALGASMVAFAAPANAA
Tfu2486s Tat MFRRLPVLAGATVLLFTTACGGGSAPRPGERTTQISDPADVDAQAA
Tfu2176s Tat MSVTEPPPRRRGRHSRARRFLTSLGATAALTAGMLGVPLATGTAHAE
Tfu1612s Tat MTATAQRTPPPPTPRRRGIIARALTCIAAAATVAAVGLVHSAAA
Tfu2788s Tat MTTVPRRSPLRKRLLVALCALGLAFTSAATAHAQ